PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID kfl00396_0130
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Klebsormidiophyceae; Klebsormidiales; Klebsormidiaceae; Klebsormidium
Family HD-ZIP
Protein Properties Length: 802aa    MW: 85905.8 Da    PI: 6.7245
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
kfl00396_0130genomeKFGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.52.7e-1983138156
                    TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    r++ ++++ +q+eeLe++F++n++p++eer+ L+++l+L+ rq+k+WFqNrR++ k
  kfl00396_0130  83 RKRYHRHSLHQIEELERAFRENPHPNEEERASLSQRLSLEPRQIKFWFQNRRTQVK 138
                    7888999*********************************************9877 PP

2START107.71.9e-342655023204
                    HHHHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGG.................CT- CS
          START   3 aeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddke.................qWd 73 
                    a +a +el + al ++p+W + +   + +n+de+ ++ + s +     +++ea ra+gvv   +a  +e+++++ +                 qW 
  kfl00396_0130 265 AVAAYEELKSVALGGSPLWEQTPggrDVLNQDEYAKRHPASATggpvgSNVEATRAEGVVMSGAASILESFMNVVPktgrdpgklhdvvrggdQWM 360
                    66778888889999************************999889*************************************************999 PP

                    TT-S....EEEEEEEECTT.......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEE CS
          START  74 etla....kaetlevissg.......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepk 157
                     +++    ka + +v+s+g        alqlm+ae+ alsplvp R + f+Ry+ +  +g wv vd Svd  ++    ++ +R++++pSg++i++ 
  kfl00396_0130 361 DQYPtivsKAGLFDVLSTGgpdgsrdRALQLMFAETHALSPLVPtRGVNFLRYCCKIAEGMWVAVDSSVDGLRDFA-RKGDIRCRRRPSGLVIKDA 455
                    99999999******************************************************************99.8****************** PP

                    CTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXX CS
          START 158 snghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqc 204
                    +ng s+vt+veh  ++ +  +  ++ + +sg+ +ga +w+a  q+q 
  kfl00396_0130 456 GNGCSTVTVVEHSVVEQHALPKEYETMAQSGALFGATRWLAVIQHQA 502
                    ********************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-2058142IPR009057Homeodomain-like
SuperFamilySSF466892.3E-1972140IPR009057Homeodomain-like
PROSITE profilePS5007118.09180140IPR001356Homeobox domain
SMARTSM003892.9E-1881144IPR001356Homeobox domain
CDDcd000868.99E-1982141No hitNo description
PfamPF000461.4E-1683138IPR001356Homeobox domain
PROSITE patternPS000270115138IPR017970Homeobox, conserved site
PROSITE profilePS5084830.803254507IPR002913START domain
SuperFamilySSF559611.17E-16255504No hitNo description
CDDcd088752.95E-68258501No hitNo description
SMARTSM002341.3E-12263504IPR002913START domain
PfamPF018521.2E-25266502IPR002913START domain
SuperFamilySSF559615.77E-11547726No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009913Biological Processepidermal cell differentiation
GO:0048497Biological Processmaintenance of floral organ identity
GO:0048825Biological Processcotyledon development
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 802 aa     Download sequence    Send to blast
MISEPPATVA GVSNLAGMEK VNEGLFGSGG EPNGKKARLS LDRKEGGVEA SSSGGGASAD  60
PARDTGASEG NSGGKMQEDD GKRKRYHRHS LHQIEELERA FRENPHPNEE ERASLSQRLS  120
LEPRQIKFWF QNRRTQVKSQ SERNENQVLR AEKDRLIKEN LYLRESLRVA QVHALQAVKG  180
GTDAERQLQL ENKRLKAEVE HLTQLVTRSL GQPPPPAGSL GTSLSLGLGL NPNAEPSLNL  240
SVAPSASVPT LNLTPVERQL VCDLAVAAYE ELKSVALGGS PLWEQTPGGR DVLNQDEYAK  300
RHPASATGGP VGSNVEATRA EGVVMSGAAS ILESFMNVVP KTGRDPGKLH DVVRGGDQWM  360
DQYPTIVSKA GLFDVLSTGG PDGSRDRALQ LMFAETHALS PLVPTRGVNF LRYCCKIAEG  420
MWVAVDSSVD GLRDFARKGD IRCRRRPSGL VIKDAGNGCS TVTVVEHSVV EQHALPKEYE  480
TMAQSGALFG ATRWLAVIQH QATRLAATTQ AGTQDSPVMT IDGRSQVSTL KPELGTHESP  540
VMTIDGRRTL FKLAKRMVTN FCIGASGAPH PSWTPISYSG PEGSATLRIQ ARKNTNNPGE  600
PTGIILSASS SFYLDSSPQQ VFTFLTNQRL RQQWDILSNG GLVEQVAQLS KGQTPGNALS  660
LFKAEPPVSG QNNMLILQES VCDPFGCMLV YAPVDTPAVQ LVIAGGDPDN VALLPSGFSI  720
FPDGNPALEH ALGLDSALLA GVGGEKETKG SLTTISFQIL VSTSEDSQLT KDSIDTVSTL  780
VWATLNRIKS ALSVNHGVPL VT
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.11e-148protodermal factor 2